Catalog  /  Regenerative Peptides  /  BPC-157 + TB-500
BPC-157 + TB-500 · 10 mg BPC-157 + TB-500
HPLC ≥99%
Per-lot COA
Sealed vial

This category groups peptides studied for their role in tissue-repair signalling pathways: angiogenesis, actin polymerisation and cytoskeletal remodelling, and…

Read the full description and all 4 compounds →

BPC-157 + TB-500Regenerative Peptides

Co-formulation of BPC-157 and thymosin β4 (Tβ4). Supplied for comparative in vitro studies of actin-binding and tissue-repair signalling.

Also searched as TB500 · thymosin beta-4 · Tβ4 · BPC157 + TB500

$59.99USD
10 mg vial · lyophilized · reconstitute before use
Select size
In stock · ships from Texas
Discreet packaging Lyophilized · sealed vial Batch-tested
Full US shipping · operating from Texas

At a glance

BPC-157 + TB-500 is two-peptide co-formulation · BPC-157 + thymosin β4.

Supplied as
Lyophilized (freeze-dried) powder in a sealed vial
Vial sizes
10 mg · 20 mg
Purity
HPLC-verified, 99% or higher
Certificate of analysis
Published per lot at kinotype.shop/coa
Ships
From Texas to all 50 US states
Intended use
Laboratory research only. Not for human or veterinary use.

Chemical data

BPC-157 + TB-500
Two-peptide co-formulation · BPC-157 + thymosin β4
BPC-157C₆₂H₉₈N₁₆O₂₂ · 1 419.5 g/mol · CAS 137525-51-0
Sequence (BPC)GEPPPGKPADDAGLV
TB-500 (Tβ4)C₂₁₂H₃₅₀N₅₆O₇₈S · 4 963.5 g/mol · CAS 77591-33-4
Sequence (Tβ4)SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
FormCo-formulated lyophilized · 3 mL vial
Purity≥99% HPLC per component
Storage2–8°C · light-protected

Handling & verification

A co-formulation of BPC-157 and thymosin β4, lyophilized together in equal parts by mass. Supplied for comparative in vitro studies of actin-binding and tissue-repair signalling, where having both peptides in one reference preparation removes a weighing step.

Presentation and storage

Supplied lyophilized in a sealed vial. The 10 mg vial contains 5 mg of each peptide; the 20 mg vial contains 10 mg of each. Store sealed at −20 °C long-term, 2–8 °C over shorter periods, away from light and moisture.

Allow the vial to reach room temperature before opening, so atmospheric moisture does not condense onto the powder.

Reconstitution

Reconstitute with bacteriostatic water. Direct the diluent down the inside wall of the vial rather than onto the powder, and swirl gently — do not shake, as agitation can denature the peptide.

  • 10 mg vial in 2 mL diluent gives 5 mg/mL combined (2.5 mg/mL of each)
  • 20 mg vial in 2 mL diluent gives 10 mg/mL combined (5 mg/mL of each)
  • 20 mg vial in 4 mL diluent gives 5 mg/mL combined (2.5 mg/mL of each)

Once reconstituted, store at 2–8 °C and protect from light. Avoid repeated freeze-thaw cycles — aliquot the stock if it will be drawn on more than a few times.

Verification

Every lot is assayed by HPLC and released at ≥99% purity. A per-lot certificate of analysis is available for this compound and states the batch number, the assay method and the measured purity.

Common questions

Does BPC-157 + TB-500 come with a certificate of analysis?

Yes. Every lot of BPC-157 + TB-500 ships with its own certificate of analysis showing HPLC purity, and the current certificate is published on our COA page before you buy — you do not have to order first or email anyone to see it.

What purity is BPC-157 + TB-500?

HPLC-verified at 99% or higher. The certificate for each lot states the measured figure, the detection wavelength and the method used, so the number can be checked rather than taken on trust.

How is BPC-157 + TB-500 supplied and where does it ship?

It is supplied as lyophilized (freeze-dried) powder in a sealed vial, protected against light and impact. Full US shipping, operating from Texas. Delivery estimates are provided by the carrier at checkout.

How should BPC-157 + TB-500 be stored?

Keep the lyophilized vial cold and dark — refrigerated for near-term use, frozen for longer storage. Once reconstituted it belongs in the refrigerator and its usable life is measured in weeks rather than months. Aliquot rather than thawing the same vial repeatedly, because freeze-thaw cycles cost more stability than most people expect.

How do I reconstitute BPC-157 + TB-500?

Add bacteriostatic water slowly down the inner wall of the vial so the stream does not strike the powder directly, then let it dissolve on its own — swirl gently if needed, never shake. The volume you add sets the concentration, so decide the concentration first and work backwards. Our free reconstitution calculator does that arithmetic and gives the volume to draw per aliquot.

Is BPC-157 + TB-500 for human use?

No. BPC-157 + TB-500 is supplied strictly as a reference material for laboratory research use only. It is not a drug, food, cosmetic or medical device, it is not for human or veterinary consumption, and it is not intended to diagnose, treat, cure or prevent any disease. We do not provide dosing guidance or protocols of any kind.

See the certificate · Reconstitution calculator · All questions

Handling guides

Other compounds

Epithalon
Epithalon
Epithalon
Synthetic tetrapeptide (Ala-Glu-Asp-Gly) derived from the pineal peptide preparation epithalamin.
$74.99
Glutathione
Glutathione
Glutathione
Endogenous tripeptide (γ-Glu-Cys-Gly) and principal intracellular thiol redox buffer.
$54.99
Melanotan-2
Melanotan-2
Melanotan-2
Cyclic synthetic analog of α-melanocyte-stimulating hormone; non-selective agonist at melanocortin receptors (MC1R / MC3R / MC4R).
$34.99
DSIP
DSIP
DSIP
Nine-residue neuropeptide (delta sleep-inducing peptide) first isolated from cerebral venous blood.
$69.99

For laboratory and research use only. Not for human or veterinary use, diagnosis, or consumption. Products are sold to qualified researchers and are not drugs, foods, or cosmetics.